|
|
|
Rat brain natriuretic peptide(1-32)
Synonyms: natriureticfactor-45 (rat brain), 1-de-l-serine-2-de-l-glutamine-3-de-l-asparticacid-4-de-l-serine-5-de-l-alanine-6-de-l-phenylalanine-7-de-l-arginine-8-de-l-isoleucine-9-de-l-glutamine-10-de-l-glutamicacid-11-de-l-arginine-12-de-l-leucine-13-de-l-arginine- | bnp (1-32) rat | 1,2-dithia-5,8,11,14,17,20,23,26,29,32,35,38,41,44,47,50-hexadecaazacyclotripentacontane,cyclic peptide deriv. | natriuretic factor-32, rat brain | brain natriuretic peptide-32 (rat) | 14-45-brain natriureticpeptide-45 (rat) (9ci) | rat brain natriureticpeptide(1-32) | b-type (brain) natriuretic peptide-32 (rat) | bnp rat | rat brain natriuretic peptide-32 | 14-45-brain natriuretic peptide-45 (rat) | rat brain natriuretic peptide(1-32) | nskmahssscfgqkidrigavsrlgcdglrlf | bnp-32 (rat) | brain natriuretic peptide (1-32), rat | bnp (51-95), rat
Formula: C146H239 N47 O44 S3
List of Suppliers
Alpha Biopharmaceuticals Co., Ltd.
Company type: Producer
Alabiochem company locates at a beautiful chinese city-SuZhou. We are a professional biochemical company engaged in researching, developing, manufacturing pharmaceutical peptide、new amino acid, peptide synthetic technique and new type of peptide. FMoc-N-Me-His(Trt)-OH is also served by Alpha Biopharmaceuticals Co., Ltd.. Moreover, we are focused on nucleic acid and other small organic compounds. Alabiochem company not only provides contact research but custom synthesis service. Alpha Biopharmaceuticals Co., Ltd. is supplier for Rat brain natriuretic peptide(1-32).
Country: P.R.China
Phone: +86-411-39042497
Telefax: +86-411-39042693
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
2,2'-Anhydro-5-methyluridine
Suppliers and manufactures - with identical CAS number as Rat brain natriuretic peptide(1-32)
For the following products supplier are listed below:
BNP-32 (rat)
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Leap Chem Co., Ltd also offers 5-Thiazolol.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Additionally Biotinyl-(Lys153·159,Leu161)-Histone H1 (149-161) (salmon) is supplied by us. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
Skyrun Industrial Co., Ltd.
Company type: Leading producer
Skyrun Industrial Co.Limited, established in 2003, a state-controlled company (By Skyrun Corp. We supply our chemical product Fmoc-L-Hydroxyproline. & High Hope) in China, specializing in developing, producing and handing raw pharmaceutical material and intermediates. We have expanded a compositive entity from initially only as a small manufacturer. We have extensive knowledge of domestic and international pharmaceutical markets. Our working range can be start from small amount in research stage to big bulk for industrial produc ...
Country: P.R.China
Phone: +86-576-84015261
Telefax: +86-576-84015261
|
|
|
How do you find
new customers?
click here
Stereokem
Stereokem is a chemistry-savvy, innovation driven company engaged in development, production and ma
Corvay Specialty Chemic
Corvay Specialty Chemicals GmbH distributes high quality specialty chemicals from selected manufact
Qingdao QY Liquid Cryst
15 years of PDLC liquid crystal production experience. Qingdao QY Liquid Crystal Co., Ltd. is a pr
Allfluoro Pharmaceutica
Founded in 2015, Allfluoro pharmaceutical co. ltd. (AFPA) is a privately held, organic fluorine com
Henan Sinowin Che
Henan Sinowin Chemical Industry Co.,Ltd. is established in 2003, it's located in Zhengzhou industri
Chemport Science & Tech
Chemport is a R&D oriented company, providing innovative synthesis solutions to the customers i
|
