www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2

H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2

Structure
Quick view: Suppliers
BGC Id:
615069306419
CAS No.:
Synonyms:
vip antagonist | vasoactive intestinal peptide antagonist | vip-ne hybrid antag | vipi | lys-pro-arg-arg-pro-tyr-vip(7-28) | (lys1 pro2 5 arg3 4 tyr6)-vasoactive & | kprrpytdnytrlrkqmavkkylnsiln-nh2 | (vip-neurotensin) hybrid antagonist | lysyl-prolyl-arginyl-arginyl-prolyl-tyrosyl-vip(7-28) | (lys1,pro2,5,arg3,4,tyr6)-vasoactive*intestinal p
Formula:
C154H257N49O40S
Molecular Weight:
3467.06

List of Suppliers

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Leap Chem Co., Ltd is supplier for H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. We are supplier of Benzofuran, 5-(methylthio)-. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many m ...
Country: P.R.China   Phone: +852-30606658   Telefax:

Safety Information

WGK Germany:
3
Storage tempuraturx:
-20°C

Most viewed

Within the past time user are also interested in the following chemicals.
Nonyl phenol [4 EO] acrylate

Suppliers and manufactures - with identical CAS number as H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2

For the following products supplier are listed below:
    VIP Antagonist


The following companies are not suppliers of H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 . This companies are suppliers for equal products with the same CAS number. CAS: 125093-93-8


Supplier of

VIP Antagonist

(CAS: 125093-93-8)

BuGuCh & Partners

Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. Holmium hexaboride is also served by BuGuCh & Partners. Our global network is a strength. Our products range from natural gas, oil and basic chemi ...
Country: Germany   Phone:   Telefax:

Hangzhou Dayangchem Co. Ltd.

Company type: Leading producer
Hangzhou DayangChem Co. Ltd is a comprehensive entity which specializes in development, production and trade of pharmaceutical, agrochemical and dyestuff intermediates as well as some special type reagents. We have an own factory and share enterprises. We act also as agent of many chemical factories and promote their products to the international market at very competitive price. We take "Credi first, Clients supreme" as our aim. We are seller of 1,3-Dimethylhydantoin. We expect to cooperate with more partners ...
Country: P.R.China   Phone: +86-571-88938639   Telefax: +86-571-8893-8652

Bachem AG

Company type: Leading producer
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. H-Thr-OH will be also provided by us. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland   Phone: +41 58 595 2021   Telefax: +41 58 595 2040


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


Wuhan Alpha & Omega Pha
This is Wuhan Alpha & Omega Pharmaceuticals LTD. We are located in Hubei province of China. We


Akzo Nobel Functional C
AkzoNobel continues to develop its position as the global leader in MCA with interregional supply c


Wuhan Biet Co., Ltd.
WUHAN BIET CO.,LTD was set up in July 2010.It specializes in theproduction,research,development and


Jiangsu Kolod Food Ingr
Jiangsu Kolod Food Ingredients Co., Ltd. is a professional manufacturer of phosphates, citrates, ch


Jinan Wanxingda Chemica
Jinan Wanxingda chemical Co.,Ltd.was established in 2007 and is located in Jinan City, Shandong Pro


Shree Gayatri Chemicals
Manufacturing company of drug intermediate and organic chemicals.Shree Gayatri Chemicals


© Copyright 1996 to 2024 by Netvertise GmbH. All rights reserved H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2