|
|
BGC > Chemicals A-Z > H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
Synonyms: vip antagonist | vasoactive intestinal peptide antagonist | vip-ne hybrid antag | vipi | lys-pro-arg-arg-pro-tyr-vip(7-28) | (lys1 pro2 5 arg3 4 tyr6)-vasoactive & | kprrpytdnytrlrkqmavkkylnsiln-nh2 | (vip-neurotensin) hybrid antagonist | lysyl-prolyl-arginyl-arginyl-prolyl-tyrosyl-vip(7-28) | (lys1,pro2,5,arg3,4,tyr6)-vasoactive*intestinal p
List of Suppliers
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Leap Chem Co., Ltd is supplier for H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. We are supplier of Benzofuran, 5-(methylthio)-.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
Nonyl phenol [4 EO] acrylate
Suppliers and manufactures - with identical CAS number as H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
For the following products supplier are listed below:
VIP Antagonist
The following companies are not suppliers of H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 . This companies are suppliers for equal products with the same CAS number. CAS: 125093-93-8
BuGuCh & Partners
Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing.
We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures.
We maintain independently or are partners of some production sites in Europe, Asia and South America. Holmium hexaboride is also served by BuGuCh & Partners. Our global network is a strength.
Our products range from natural gas, oil and basic chemi ...
Country: Germany
Phone:
Telefax:
Hangzhou Dayangchem Co. Ltd.
Company type: Leading producer
Hangzhou DayangChem Co. Ltd is a comprehensive entity which specializes in development, production and trade of pharmaceutical, agrochemical and dyestuff intermediates as well as some special type reagents. We have an own factory and share enterprises. We act also as agent of many chemical factories and promote their products to the international market at very competitive price.
We take "Credi first, Clients supreme" as our aim. We are seller of 1,3-Dimethylhydantoin. We expect to cooperate with more partners ...
Country: P.R.China
Phone: +86-571-88938639
Telefax: +86-571-8893-8652
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. H-Thr-OH will be also provided by us. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
|
|
|
How do you find new customers?
click here
Wuhan Alpha & Omega Pha
This is Wuhan Alpha & Omega Pharmaceuticals LTD. We are located in Hubei province of China. We
Akzo Nobel Functional C
AkzoNobel continues to develop its position as the global leader in MCA with interregional supply c
Wuhan Biet Co., Ltd.
WUHAN BIET CO.,LTD was set up in July 2010.It specializes in theproduction,research,development and
Jiangsu Kolod Food Ingr
Jiangsu Kolod Food Ingredients Co., Ltd. is a professional manufacturer of phosphates, citrates, ch
Jinan Wanxingda Chemica
Jinan Wanxingda chemical Co.,Ltd.was established in 2007 and is located in Jinan City, Shandong Pro
Shree Gayatri Chemicals
Manufacturing company of drug intermediate and organic chemicals.Shree Gayatri Chemicals
|